PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0202s0031.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28463.1 Da    PI: 9.5433
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0202s0031.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.65.1e-312473150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+
  Cagra.0202s0031.1.p 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 73
                         79***********************************************8 PP

2K-box106.72.8e-35951907100
                K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk..kekelqeenkaL 94 
                           s++ea+++++qqe++kL+++i+ +q+ +Rh+lGe+L+sL++keL++Le++Lek+++++RskK+e+l+++ie++qk  ke elq++n++L
  Cagra.0202s0031.1.p  95 PSVTEANTQYYQQEASKLRRQIRDIQNLNRHILGESLGSLNFKELKNLESRLEKGISRVRSKKHEMLVAEIEYMQKrvKEIELQNDNMYL 184
                          45899**********************************************************************94457789999**** PP

                K-box  95 rkklee 100
                          r+k+ e
  Cagra.0202s0031.1.p 185 RSKITE 190
                          **9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.1E-401675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.3891676IPR002100Transcription factor, MADS-box
CDDcd002653.32E-431790No hitNo description
SuperFamilySSF554551.96E-321788IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-321838IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PfamPF003193.3E-262572IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-323853IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-325374IPR002100Transcription factor, MADS-box
PfamPF014861.2E-24100188IPR002487Transcription factor, K-box
PROSITE profilePS5129714.927102194IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MEDGASNEAA ESSKKIGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL  60
VIFSTRGRLY EYANNSVRGT IERYKKACSD AVNPPSVTEA NTQYYQQEAS KLRRQIRDIQ  120
NLNRHILGES LGSLNFKELK NLESRLEKGI SRVRSKKHEM LVAEIEYMQK RVKEIELQND  180
NMYLRSKITE RAGLQQQESS VIHQGTVYES GVTSSHQSEQ YNRNYIPVNL LEPNHNSSNQ  240
DQPPLQLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-201684169Myocyte-specific enhancer factor 2B
1tqe_Q3e-201684169Myocyte-specific enhancer factor 2B
1tqe_R3e-201684169Myocyte-specific enhancer factor 2B
1tqe_S3e-201684169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5517690.0EU551769.1 Capsella bursa-pastoris SCHATTERPROOF2-like protein (SHP2b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295872.10.0hypothetical protein CARUB_v10025002mg
SwissprotP293851e-175AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBLR0HTN50.0R0HTN5_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_40020191e-178(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33412350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.21e-167MIKC_MADS family protein